GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist onGLP-2 receptor(EC₅₀=5.8 nM)^[1][2].

GLP-2 is secreted as a 33-amino acid peptide, but is rapidly degraded at an N-terminus site to GLP-2(3-33) in circulation, in large part, by dipeptidylpeptidase IV (DPPIV). GLP-2 (3-33) acts as a partial agonist with potential competitive antagonistic properties on the GLP-2 receptor. In the GLP-2 receptor-binding assay, the binding IC₅₀for GLP-2 1–33 was 3.1 nM, and it was 41 nM for GLP-2 3-33. Thus, GLP-2 3–33 had 7.5% binding affinity compared to GLP-2 1-33^[1].

GLP-2(3-33) (60 ng; once a day i.p. for 4 weeks) increases dyslipidemia and hepatic lipid accumulation in HFD-fed mice^[2].

3557.89

Solid

C₁₅₆H₂₄₂N₄₀O₅₃S

275801-62-2

DGSFSDEMNTILDNLAARDFINWLIQTKITD

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)